PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10000065m
Common NameCARUB_v10000065mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family ARF
Protein Properties Length: 1205aa    MW: 133890 Da    PI: 7.1951
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10000065mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B365.76.6e-21127214183
                      EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83 
                      f+k+lt sd++++g +++p++ ae++      +++++++ +l+ +d + ++W++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F 
  Carubv10000065m 127 FCKTLTASDTSTHGGFSVPRRAAEKIfpaldfSMQPPCQ-ELVAKDIHDNTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFI 214
                      99*****************************98888885.9**********************************************96 PP

2Auxin_resp117.41.2e-38279361183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      aaha +++s+F+++YnPra+++eFvv+++k+ ka++ +vs+GmRf+m fete++  rr++Gtv+g+sdldpvrW+nS+Wr+L+
  Carubv10000065m 279 AAHANANNSPFTIFYNPRAAPAEFVVPLAKYTKAMYAQVSLGMRFRMIFETEECGVRRYMGTVTGISDLDPVRWKNSQWRNLQ 361
                      799******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.7E-38117224IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.9E-37121268IPR015300DNA-binding pseudobarrel domain
CDDcd100179.19E-19126220No hitNo description
PROSITE profilePS5086310.334127231IPR003340B3 DNA binding domain
SMARTSM010192.0E-15127232IPR003340B3 DNA binding domain
PfamPF023625.0E-19127214IPR003340B3 DNA binding domain
PfamPF065071.1E-33279361IPR010525Auxin response factor
PfamPF023091.9E-910751163IPR033389AUX/IAA domain
PROSITE profilePS5174526.95610771170IPR000270PB1 domain
SuperFamilySSF542771.08E-810901155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009638Biological Processphototropism
GO:0009723Biological Processresponse to ethylene
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009785Biological Processblue light signaling pathway
GO:0010311Biological Processlateral root formation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1205 aa     Download sequence    Send to blast
MKAPSSNGVS PNPVEGERRN INSELWHACA GPLISLPPAG SLVVYFPQGH SEQVAASMQK  60
QTDFIPSYPN LPSKLICMLH NVTLNADPET DEVYAQMTLQ PVNKYDRDAL LASDMGLKLN  120
RQPNEFFCKT LTASDTSTHG GFSVPRRAAE KIFPALDFSM QPPCQELVAK DIHDNTWTFR  180
HIYRGQPKRH LLTTGWSVFV STKRLFAGDS VLFIRYINLN VPMLFRYLFV KMLTSFHFQL  240
RDGKAQLLLG IRRANRQQPA LSSSVISSDS MHIGVLAAAA HANANNSPFT IFYNPRAAPA  300
EFVVPLAKYT KAMYAQVSLG MRFRMIFETE ECGVRRYMGT VTGISDLDPV RWKNSQWRNL  360
QIGWDESAAG DRPSRVSVWD IEPVLTPFYI CPPPFFRPRF GGQPGMPDDD TDMESALKRA  420
MPWLDNSSEM KDASSTIFPG LSLVQWMNMQ QQQQNGQLPS AAAQPGFFPS MLSPTTALHN  480
NLGGTDDPSK LLSFQMPQGG VSSSNLQFNK PNVQSPMSQL PQPSTTLSQQ QQLQQLLHSS  540
LNQQQQQSQS QQQQQQQLLQ QQQQLQSQQH SNNNQSQSQQ QQQQQQQQHL QQQQQQQQQQ  600
LLQQQHQQPL QQQTQQQQQR TQSLQSHSRS QPQPQPQPQP QPHKLQQLQL PQNQLYNGQQ  660
AAQQLQAQQH LQPQLVSGSM ASSAITPPSS SHNQSFQQQQ QSKKLQQAHH HLGASTCQSS  720
VIETSKSSSN LMSVPPQETQ FQRQVEQQQP PGLSGQNQQT LLQQKAHQAQ AQQIFQQSLL  780
EQPHLQFQLL QRLQQQQQQQ QQQQFLSPQS QLPHHQLQSQ QLQQLPALSQ GHQFPSSCIN  840
NGLSTLQPPQ MLVSRPQEKQ HPPVGGGVKA YSGITDGGDA PSSSTSPSTN NCQISSSGFL  900
NRTQSGPAIL IPDAAIDMSS NLVQDLYSKS DMRLKQELVG QQKSKASLTD HHLEASASGT  960
SYGLDGGDNN RQQNFLAPTF GLDGDSRNSL LGGANVDNGF VPDTLLSRGY DSQKDLQNML  1020
SNYGGVTTDI GTEMSTSAVR TQSFGVPNVP AISNDLAVND AGVLGGGLWP AQTQRMRTYT  1080
KVQKRGSVGR SIDVNRYRGY DELRHDLARM FGIEGQLEDP QTSDWKLVYV DHENDILLVG  1140
DDPWEEFVNC VQSIKILSSA EVQQMSLDGN FAGVPVTNQA CSGGDSGNAW RGHYDDNSAT  1200
SFNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1622138251388Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0421950.0AF042195.1 Arabidopsis thaliana auxin response factor 7 (ARF7) mRNA, complete cds.
GenBankAY0805950.0AY080595.1 Arabidopsis thaliana unknown protein (At5g20730) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006286921.10.0hypothetical protein CARUB_v10000065mg
TrEMBLR0GSG50.0R0GSG5_9BRAS; Auxin response factor
STRINGBra002327.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26292665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20730.20.0ARF family protein